SMUG1 anticorps (Middle Region)

N° du produit ABIN630668

Détail du produit anti-SMUG1 anticorps

Antigène: SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMUG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SMUG1 antibody was raised against the middle region of SMUG1

Purification: Affinity purified

Immunogène: SMUG1 antibody was raised using the middle region of SMUG1 corresponding to a region with amino acids IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMUG1 Blocking Peptide, catalog no. 33R-4200, is also available for use as a blocking control in assays to test for specificity of this SMUG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMUG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMUG1

Antigène: SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))

Autre désignation: SMUG1 (SMUG1 Produits)

Synonymes: anticorps SMUG1, anticorps xsmug1, anticorps 1200013B09Rik, anticorps A930006H09Rik, anticorps C85220, anticorps FDG, anticorps HMUDG, anticorps UNG3, anticorps single-strand-selective monofunctional uracil-DNA glycosylase 1, anticorps single-strand selective monofunctional uracil DNA glycosylase, anticorps single-strand-selective monofunctional uracil-DNA glycosylase 1 L homeolog, anticorps SMUG1, anticorps smug1, anticorps smuG1, anticorps smuG, anticorps LOC5577584, anticorps CpipJ_CPIJ002767, anticorps Smug1, anticorps smug1.L

Sujet: SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Réparation de l'ADN