SMUG1 anticorps (Middle Region)
-
- Antigène Voir toutes SMUG1 Anticorps
- SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SMUG1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SMUG1 antibody was raised against the middle region of SMUG1
- Purification
- Affinity purified
- Immunogène
- SMUG1 antibody was raised using the middle region of SMUG1 corresponding to a region with amino acids IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC
- Top Product
- Discover our top product SMUG1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SMUG1 Blocking Peptide, catalog no. 33R-4200, is also available for use as a blocking control in assays to test for specificity of this SMUG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMUG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))
- Autre désignation
- SMUG1 (SMUG1 Produits)
- Synonymes
- anticorps SMUG1, anticorps xsmug1, anticorps 1200013B09Rik, anticorps A930006H09Rik, anticorps C85220, anticorps FDG, anticorps HMUDG, anticorps UNG3, anticorps single-strand-selective monofunctional uracil-DNA glycosylase 1, anticorps single-strand selective monofunctional uracil DNA glycosylase, anticorps single-strand-selective monofunctional uracil-DNA glycosylase 1 L homeolog, anticorps SMUG1, anticorps smug1, anticorps smuG1, anticorps smuG, anticorps LOC5577584, anticorps CpipJ_CPIJ002767, anticorps Smug1, anticorps smug1.L
- Sujet
- SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.
- Poids moléculaire
- 30 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN
-