MAP2K7 anticorps (Middle Region)

N° du produit ABIN631268

L’anticorps anti-MAP2K7 Polyclonal Lapin est utilisé pour la détection de MAP2K7 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour MAP2K7 anticorps (Middle Region) (ABIN631268)

Antigène: MAP2K7 (Mitogen-Activated Protein Kinase Kinase 7 (MAP2K7))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP2K7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAP2K7 anticorps

Épitope: Middle Region

Specificité: MAP2 K7 antibody was raised against the middle region of MAP2 7

Purification: Affinity purified

Immunogène: MAP2 K7 antibody was raised using the middle region of MAP2 7 corresponding to a region with amino acids ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP2K7 Blocking Peptide, (ABIN938081), is also available for use as a blocking control in assays to test for specificity of this MAP2K7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP2K7

Antigène: MAP2K7 (Mitogen-Activated Protein Kinase Kinase 7 (MAP2K7))

Autre désignation: MAP2K7

Sujet: MAP2K7 is a stress activated, dual specificity kinase that activates the JUN kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Signalisation MAPK, Signalisation TLR, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, BCR Signaling