MAP2K7 anticorps (Middle Region)

N° du produit ABIN631268

Détail du produit anti-MAP2K7 anticorps

Antigène: MAP2K7 (Mitogen-Activated Protein Kinase Kinase 7 (MAP2K7))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP2K7 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAP2 K7 antibody was raised against the middle region of MAP2 7

Purification: Affinity purified

Immunogène: MAP2 K7 antibody was raised using the middle region of MAP2 7 corresponding to a region with amino acids ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP2K7 Blocking Peptide, catalog no. 33R-2695, is also available for use as a blocking control in assays to test for specificity of this MAP2K7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP2K7

Antigène: MAP2K7 (Mitogen-Activated Protein Kinase Kinase 7 (MAP2K7))

Autre désignation: MAP2K7 (MAP2K7 Produits)

Synonymes: anticorps MAP2K7, anticorps 2, anticorps JNKK, anticorps Jnkk2, anticorps Mapkk7, anticorps Mek7, anticorps Mkk7, anticorps MAPKK7, anticorps MKK7, anticorps PRKMK7, anticorps SAPKK-4, anticorps SAPKK4, anticorps 5930412N11Rik, anticorps JNKK 2, anticorps MAPKK 7, anticorps MEK 7, anticorps Prkmk7, anticorps sek2, anticorps si:ch211-254d18.2, anticorps map2k7-A, anticorps mitogen-activated protein kinase kinase 7, anticorps mitogen activated protein kinase kinase 7, anticorps mitogen-activated protein kinase kinase 7 L homeolog, anticorps MAP2K7, anticorps Map2k7, anticorps map2k7, anticorps map2k7.L

Sujet: MAP2K7 is a stress activated, dual specificity kinase that activates the JUN kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Signalisation MAPK, Signalisation TLR, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, BCR Signaling