PRKACB anticorps (Middle Region)

N° du produit ABIN631277

Détail du produit anti-PRKACB anticorps

Antigène: PRKACB (Protein Kinase, CAMP Dependent, Catalytic, beta (PRKACB))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKACB est non-conjugé

Application: Western Blotting (WB)

Specificité: PRKACB antibody was raised against the middle region of PRKACB

Purification: Affinity purified

Immunogène: PRKACB antibody was raised using the middle region of PRKACB corresponding to a region with amino acids NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKACB Blocking Peptide, catalog no. 33R-6712, is also available for use as a blocking control in assays to test for specificity of this PRKACB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKACB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRKACB

Antigène: PRKACB (Protein Kinase, CAMP Dependent, Catalytic, beta (PRKACB))

Autre désignation: PRKACB (PRKACB Produits)

Synonymes: anticorps PKACB, anticorps XPKAbeta, anticorps kin-1, anticorps pkacb, anticorps prkacba, anticorps PRKACB, anticorps prkacb, anticorps wu:fz54b03, anticorps zgc:110804, anticorps Pkacb, anticorps protein kinase cAMP-activated catalytic subunit beta, anticorps protein kinase cAMP-activated catalytic subunit beta S homeolog, anticorps protein kinase, cAMP-dependent, catalytic, beta, anticorps protein kinase, cAMP-dependent, catalytic, beta b, anticorps protein kinase, cAMP dependent, catalytic, beta, anticorps PRKACB, anticorps prkacb.S, anticorps prkacb, anticorps Prkacb, anticorps prkacbb

Sujet: CAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: AMPK Signaling, Signalisation Hedgehog, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, M Phase, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma, Lipid Metabolism