GBL anticorps

N° du produit ABIN631915

Détail du produit anti-GBL anticorps

Antigène: GBL (G protein beta subunit-like (GBL))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GBL est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GBL antibody was raised using a synthetic peptide corresponding to a region with amino acids CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GBL Blocking Peptide, catalog no. 33R-1639, is also available for use as a blocking control in assays to test for specificity of this GBL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GBL

Antigène: GBL (G protein beta subunit-like (GBL))

Autre désignation: GBL (GBL Produits)

Synonymes: anticorps gbl, anticorps lts8, anticorps GBL, anticorps GbetaL, anticorps LST8, anticorps POP3, anticorps WAT1, anticorps 0610033N12Rik, anticorps AA409454, anticorps AI505104, anticorps AI851821, anticorps Gbl, anticorps fi37e04, anticorps wu:fi37e04, anticorps zgc:55455, anticorps zgc:85668, anticorps MTOR associated protein, LST8 homolog L homeolog, anticorps MTOR associated protein, LST8 homolog, anticorps MTOR associated protein, LST8 homolog (S. cerevisiae), anticorps mlst8.L, anticorps MLST8, anticorps Mlst8, anticorps mlst8

Sujet: GBL is the subunit of both mTORC1 and mTORC2, which regulate cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino-acids. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Actin Filament Polymerization, Autophagy, CXCR4-mediated Signaling Events, BCR Signaling, L'effet Warburg