SLC12A1 anticorps
-
- Antigène Voir toutes SLC12A1 Anticorps
- SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))
-
Reactivité
- Rat, Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC12A1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- SLC12 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
- Top Product
- Discover our top product SLC12A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC12A1 Blocking Peptide, catalog no. 33R-6671, is also available for use as a blocking control in assays to test for specificity of this SLC12A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))
- Autre désignation
- SLC12A1 (SLC12A1 Produits)
- Synonymes
- anticorps slc12a1, anticorps SLC12A1, anticorps DKFZp469A2020, anticorps BSC1, anticorps NKCC2, anticorps Nkcc2, anticorps AI788571, anticorps D630042G03Rik, anticorps mBSC1, anticorps urehr3, anticorps si:ch211-220f12.1, anticorps solute carrier family 12 member 1, anticorps solute carrier family 12, member 1, anticorps si:ch211-220f12.1, anticorps SLC12A1, anticorps Slc12a1
- Sujet
- The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
- Poids moléculaire
- 47 kDa (MW of target protein)
-