RALB anticorps
-
- Antigène Voir toutes RALB (Ralb) Anticorps
- RALB (Ralb) (V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RALB est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RALB antibody was raised using a synthetic peptide corresponding to a region with amino acids FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE
- Top Product
- Discover our top product Ralb Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RALB Blocking Peptide, catalog no. 33R-3044, is also available for use as a blocking control in assays to test for specificity of this RALB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RALB (Ralb) (V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb))
- Autre désignation
- RALB (Ralb Produits)
- Synonymes
- anticorps dRalb, anticorps 5730472O18Rik, anticorps Ral B, anticorps ralb, anticorps xralb, anticorps zgc:100801, anticorps KRAS2, anticorps k-ras, anticorps RAS like proto-oncogene B, anticorps v-ral simian leukemia viral oncogene B, anticorps v-ral simian leukemia viral oncogene homolog B L homeolog, anticorps v-ral simian leukemia viral oncogene homolog Ba (ras related), anticorps v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein), anticorps RALB, anticorps Ralb, anticorps ralb.L, anticorps ralba, anticorps ralb
- Sujet
- This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors.
- Poids moléculaire
- 23 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway, CXCR4-mediated Signaling Events
-