ALKBH2 anticorps

N° du produit ABIN632988

Cet anticorps anti-ALKBH2 Polyclonal Lapin (ABIN632988) détecte spécifiquement ALKBH2 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ALKBH2 anticorps (ABIN632988)

Antigène: ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALKBH2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ALKBH2 anticorps

Purification: Affinity purified

Immunogène: ALKBH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALKBH2 Blocking Peptide, (ABIN5612025), is also available for use as a blocking control in assays to test for specificity of this ALKBH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALKBH2

Antigène: ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))

Autre désignation: ALKBH2

Sujet: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Réparation de l'ADN