ALKBH2 anticorps

N° du produit ABIN632988

Détail du produit anti-ALKBH2 anticorps

Antigène: ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALKBH2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ALKBH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALKBH2 Blocking Peptide, catalog no. 33R-9735, is also available for use as a blocking control in assays to test for specificity of this ALKBH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALKBH2

Antigène: ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))

Autre désignation: ALKBH2 (ALKBH2 Produits)

Synonymes: anticorps si:dkey-65b12.2, anticorps ABH2, anticorps 9530023G02, anticorps AU016977, anticorps Abh2, anticorps mABH2, anticorps RGD1306377, anticorps alkB homolog 2, alpha-ketoglutarate dependent dioxygenase, anticorps alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase, anticorps ALKBH2, anticorps alkbh2, anticorps Alkbh2

Sujet: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Réparation de l'ADN