DCC anticorps (Middle Region)

N° du produit ABIN633057

Détail du produit anti-DCC anticorps

Antigène: DCC (Deleted in Colorectal Carcinoma (DCC))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCC est non-conjugé

Application: Western Blotting (WB)

Specificité: DCC antibody was raised against the middle region of DCC

Purification: Affinity purified

Immunogène: DCC antibody was raised using the middle region of DCC corresponding to a region with amino acids PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DCC Blocking Peptide, catalog no. 33R-7153, is also available for use as a blocking control in assays to test for specificity of this DCC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCC

Antigène: DCC (Deleted in Colorectal Carcinoma (DCC))

Autre désignation: DCC (DCC Produits)

Synonymes: anticorps CRC18, anticorps CRCR1, anticorps IGDCC1, anticorps MRMV1, anticorps DCC, anticorps zdcc, anticorps C030036D22Rik, anticorps Igdcc1, anticorps xdcc, anticorps XDCCa, anticorps dcca-A, anticorps Dcc, anticorps DCC netrin 1 receptor, anticorps deleted in colorectal carcinoma, anticorps netrin receptor DCC, anticorps DCC, anticorps dcc, anticorps Dcc, anticorps LOC100712666

Sujet: This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma.

Poids moléculaire: 158 kDa (MW of target protein)

Pathways: Regulation of Cell Size