FHIT anticorps (Middle Region)

N° du produit ABIN633160

Détail du produit anti-FHIT anticorps

Antigène: FHIT (Fragile Histidine Triad (FHIT))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FHIT est non-conjugé

Application: Western Blotting (WB)

Specificité: FHIT antibody was raised against the middle region of FHIT

Purification: Affinity purified

Immunogène: FHIT antibody was raised using the middle region of FHIT corresponding to a region with amino acids VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FHIT Blocking Peptide, catalog no. 33R-9585, is also available for use as a blocking control in assays to test for specificity of this FHIT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FHIT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FHIT

Antigène: FHIT (Fragile Histidine Triad (FHIT))

Autre désignation: FHIT (FHIT Produits)

Synonymes: anticorps AP3Aase, anticorps FRA3B, anticorps FHIT, anticorps zgc:73176, anticorps AW045638, anticorps Fra14A2, anticorps LOC100223655, anticorps fragile histidine triad, anticorps fragile histidine triad gene, anticorps fragile histidine triad protein, anticorps fragile histidine triad L homeolog, anticorps FHIT, anticorps Fhit, anticorps fhit, anticorps PY07476, anticorps fhit.L

Sujet: This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.

Poids moléculaire: 17 kDa (MW of target protein)