SLIT1 anticorps

N° du produit ABIN633869

Détail du produit anti-SLIT1 anticorps

Antigène: SLIT1 (Slit Homolog 1 (SLIT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLIT1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLIT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLIT1 Blocking Peptide, catalog no. 33R-3156, is also available for use as a blocking control in assays to test for specificity of this SLIT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLIT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLIT1

Antigène: SLIT1 (Slit Homolog 1 (SLIT1))

Autre désignation: SLIT1 (SLIT1 Produits)

Synonymes: anticorps Slil1, anticorps mKIAA0813, anticorps MEGF4, anticorps SLIL1, anticorps SLIT-1, anticorps SLIT3, anticorps megf4, anticorps slil1, anticorps slit-1, anticorps SLIT1, anticorps slit3, anticorps slit homolog 1 (Drosophila), anticorps slit guidance ligand 1, anticorps slit guidance ligand 1 S homeolog, anticorps slit homolog 1 protein, anticorps slit homolog 1b (Drosophila), anticorps slit homolog 1a (Drosophila), anticorps Slit1, anticorps SLIT1, anticorps slit1.S, anticorps slit1, anticorps LOC100459557, anticorps slit1b, anticorps slit1a

Sujet: SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors.

Poids moléculaire: 168 kDa (MW of target protein)

Pathways: Regulation of Cell Size