Cholesterol Esterase anticorps

N° du produit ABIN633939

Détail du produit anti-Cholesterol Esterase anticorps

Antigène: Cholesterol Esterase (CEL)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cholesterol Esterase est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxyl Ester Lipase Blocking Peptide, catalog no. 33R-9855, is also available for use as a blocking control in assays to test for specificity of this Carboxyl Ester Lipase antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cholesterol Esterase

Antigène: Cholesterol Esterase (CEL)

Autre désignation: Carboxyl Ester Lipase (CEL Produits)

Synonymes: anticorps SC8F4.24, anticorps BAL, anticorps BSDL, anticorps BSSL, anticorps CELL, anticorps CEase, anticorps FAP, anticorps FAPP, anticorps LIPA, anticorps MODY8, anticorps 1810036E18Rik, anticorps Bal, anticorps Bssl, anticorps carboxyl ester lipase, anticorps cholesterol esterase, anticorps hypothetical protein, anticorps CEL, anticorps SCO5420, anticorps Tfu_2331, anticorps SARE_RS01070, anticorps RSal33209_1252, anticorps Caci_5976, anticorps Ndas_0054, anticorps Micau_5972, anticorps ML5_2523, anticorps Cel, anticorps cel

Sujet: CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: Lipid Metabolism