Cholesterol Esterase anticorps

N° du produit ABIN633939

Cet anticorps anti-Cholesterol Esterase Polyclonal Lapin (ABIN633939) détecte spécifiquement Cholesterol Esterase dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Cholesterol Esterase anticorps (ABIN633939)

Antigène: Cholesterol Esterase (CEL)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cholesterol Esterase est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Cholesterol Esterase anticorps

Purification: Affinity purified

Immunogène: Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxyl Ester Lipase Blocking Peptide, (ABIN5612609), is also available for use as a blocking control in assays to test for specificity of this Carboxyl Ester Lipase antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cholesterol Esterase

Antigène: Cholesterol Esterase (CEL)

Autre désignation: Carboxyl Ester Lipase

Sujet: CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: Lipid Metabolism