CYP2B6 anticorps (Middle Region)

N° du produit ABIN633985

Détail du produit anti-CYP2B6 anticorps

Antigène: CYP2B6 (Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP2B6 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP2 B6 antibody was raised against the middle region of CYP2 6

Purification: Affinity purified

Immunogène: CYP2 B6 antibody was raised using the middle region of CYP2 6 corresponding to a region with amino acids QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP2B6 Blocking Peptide, catalog no. 33R-7624, is also available for use as a blocking control in assays to test for specificity of this CYP2B6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP2B6

Antigène: CYP2B6 (Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6))

Autre désignation: CYP2B6 (CYP2B6 Produits)

Synonymes: anticorps CPB6, anticorps CYP2B, anticorps CYP2B7, anticorps CYP2B7P, anticorps CYPIIB6, anticorps EFVM, anticorps IIB1, anticorps P450, anticorps CPF3, anticorps CYP4F, anticorps LTB4H, anticorps CYP2B30, anticorps CYP2B11, anticorps CYPIIB11, anticorps 21-OH, anticorps 21OH, anticorps 21OHA, anticorps 21OHB, anticorps CYP21OH-A, anticorps Cyp21, anticorps Cyp21-ps1, anticorps Cyp21B, anticorps Cyp21a2-ps, anticorps Cyp21a2ps, anticorps Oh21-1, anticorps Oh21-2, anticorps CYP2B6, anticorps cytochrome P450 family 2 subfamily B member 6, anticorps cytochrome P450 family 4 subfamily F member 3, anticorps cytochrome P450, family 2, subfamily B, polypeptide 6, anticorps cytochrome P450 family 2 subfamily B member 6 L homeolog, anticorps cytochrome P450 2B11, anticorps cytochrome P450, family 21, subfamily a, polypeptide 1, anticorps cytochrome P450 subfamily 2B, anticorps cytochrome P450 2B11-like, anticorps CYP2B6, anticorps CYP4F3, anticorps cyp2b6.L, anticorps Cyp21a1, anticorps LOC100068603

Sujet: This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Poids moléculaire: 56 kDa (MW of target protein)