CYP2B6 anticorps (Middle Region)
-
- Antigène Voir toutes CYP2B6 Anticorps
- CYP2B6 (Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP2B6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP2 B6 antibody was raised against the middle region of CYP2 6
- Purification
- Affinity purified
- Immunogène
- CYP2 B6 antibody was raised using the middle region of CYP2 6 corresponding to a region with amino acids QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL
- Top Product
- Discover our top product CYP2B6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP2B6 Blocking Peptide, catalog no. 33R-7624, is also available for use as a blocking control in assays to test for specificity of this CYP2B6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP2B6 (Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6))
- Autre désignation
- CYP2B6 (CYP2B6 Produits)
- Synonymes
- anticorps CPB6, anticorps CYP2B, anticorps CYP2B7, anticorps CYP2B7P, anticorps CYPIIB6, anticorps EFVM, anticorps IIB1, anticorps P450, anticorps CPF3, anticorps CYP4F, anticorps LTB4H, anticorps CYP2B30, anticorps CYP2B11, anticorps CYPIIB11, anticorps 21-OH, anticorps 21OH, anticorps 21OHA, anticorps 21OHB, anticorps CYP21OH-A, anticorps Cyp21, anticorps Cyp21-ps1, anticorps Cyp21B, anticorps Cyp21a2-ps, anticorps Cyp21a2ps, anticorps Oh21-1, anticorps Oh21-2, anticorps CYP2B6, anticorps cytochrome P450 family 2 subfamily B member 6, anticorps cytochrome P450 family 4 subfamily F member 3, anticorps cytochrome P450, family 2, subfamily B, polypeptide 6, anticorps cytochrome P450 family 2 subfamily B member 6 L homeolog, anticorps cytochrome P450 2B11, anticorps cytochrome P450, family 21, subfamily a, polypeptide 1, anticorps cytochrome P450 subfamily 2B, anticorps cytochrome P450 2B11-like, anticorps CYP2B6, anticorps CYP4F3, anticorps cyp2b6.L, anticorps Cyp21a1, anticorps LOC100068603
- Sujet
- This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Poids moléculaire
- 56 kDa (MW of target protein)
-