PDPK1 anticorps (Middle Region)

N° du produit ABIN634323

Détail du produit anti-PDPK1 anticorps

Antigène: PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDPK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PDK1 antibody was raised against the middle region of PDK1

Purification: Affinity purified

Immunogène: PDK1 antibody was raised using the middle region of PDK1 corresponding to a region with amino acids ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDK1 Blocking Peptide, catalog no. 33R-1567, is also available for use as a blocking control in assays to test for specificity of this PDK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDPK1

Antigène: PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))

Autre désignation: PDK1 (PDPK1 Produits)

Synonymes: anticorps pdpk1, anticorps MGC82080, anticorps PDK1, anticorps PDPK2, anticorps PRO0461, anticorps Pdk1, anticorps zgc:153787, anticorps 3'-phosphoinositide-dependent protein kinase 1, anticorps 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1, anticorps ATPDK1, anticorps AtPDK1, anticorps T32M21.110, anticorps T32M21_110, anticorps zgc:77318, anticorps 3-phosphoinositide dependent protein kinase 1, anticorps 3-phosphoinositide dependent protein kinase 1 L homeolog, anticorps 3-phosphoinositide dependent protein kinase-1, anticorps 3-phosphoinositide dependent protein kinase 1a, anticorps 3-phosphoinositide-dependent protein kinase 1, anticorps 3'-phosphoinositide-dependent protein kinase 1, anticorps 3-phosphoinositide dependent protein kinase 1b, anticorps PDPK1, anticorps pdpk1.L, anticorps pdpk1, anticorps Pdpk1, anticorps pdpk1a, anticorps LOC100380750, anticorps pdk-1, anticorps PDK1, anticorps pdpk1b

Sujet: Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Cell-Cell Junction Organization, Regulation of Cell Size, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals