MYD88 anticorps

N° du produit ABIN634396

Cet anticorps Lapin Polyclonal détecte spécifiquement MYD88 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour MYD88 anticorps (ABIN634396)

Antigène: MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYD88 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MYD88 anticorps

Purification: Affinity purified

Immunogène: MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYD88 Blocking Peptide, (ABIN5614890), is also available for use as a blocking control in assays to test for specificity of this MYD88 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYD88 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYD88

Antigène: MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))

Autre désignation: MYD88

Sujet: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Signalisation TLR, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades