MYD88 anticorps
-
- Antigène Voir toutes MYD88 Anticorps
- MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MYD88 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR
- Top Product
- Discover our top product MYD88 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MYD88 Blocking Peptide, catalog no. 33R-9003, is also available for use as a blocking control in assays to test for specificity of this MYD88 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYD88 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))
- Autre désignation
- MYD88 (MYD88 Produits)
- Synonymes
- anticorps MYD88D, anticorps XMyD88, anticorps myd88d, anticorps MGC84928, anticorps CG2078, anticorps DMMYD88, anticorps DmMyD88, anticorps DmMyd88, anticorps Dmel\\CG2078, anticorps EP(2)2535, anticorps Kra, anticorps LD20892, anticorps MYD88, anticorps MyD88, anticorps Myd88F, anticorps dMyD88, anticorps dMyd88, anticorps kra, anticorps myd88, anticorps zgc:103541, anticorps GB12344, anticorps NV10640, anticorps myd88-a, anticorps myd88-b, anticorps myeloid differentiation primary response 88, anticorps myeloid differentiation primary response 88 S homeolog, anticorps myeloid differentiation primary response gene 88, anticorps CG2078 gene product from transcript CG2078-RB, anticorps myeloid differentiation primary response protein MyD88-A, anticorps myeloid differentiation primary response protein MyD88, anticorps myeloid differentiation factor 88, anticorps myeloid differentiation primary response 88 L homeolog, anticorps MYD88, anticorps myd88.S, anticorps Myd88, anticorps myd88, anticorps LOC413194, anticorps LOC100118553, anticorps LOC575153, anticorps myd88.L
- Sujet
- This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways.
- Poids moléculaire
- 33 kDa (MW of target protein)
- Pathways
- Signalisation NF-kappaB, Signalisation TLR, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades
-