CD8B anticorps (Middle Region)
-
- Antigène Voir toutes CD8B Anticorps
- CD8B (CD8b Molecule (CD8B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CD8B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CD8 B antibody was raised against the middle region of CD8
- Purification
- Affinity purified
- Immunogène
- CD8 B antibody was raised using the middle region of CD8 corresponding to a region with amino acids KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR
- Top Product
- Discover our top product CD8B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CD8B Blocking Peptide, catalog no. 33R-4582, is also available for use as a blocking control in assays to test for specificity of this CD8B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CD8B (CD8b Molecule (CD8B))
- Autre désignation
- CD8B (CD8B Produits)
- Synonymes
- anticorps Cd8b, anticorps Ly-3, anticorps Ly-C, anticorps Lyt-3, anticorps CD8B1, anticorps LEU2, anticorps LY3, anticorps LYT3, anticorps P37, anticorps Cd8b1, anticorps CD8b molecule, anticorps CD8 antigen, beta chain 1, anticorps Cd8b, anticorps CD8B, anticorps Cd8b1
- Sujet
- The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognise antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. CD8B is the CD8 beta chain isoforms.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- TCR Signaling
-