PTK2B anticorps (C-Term)
-
- Antigène Voir toutes PTK2B Anticorps
- PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTK2B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PTK2 B antibody was raised against the C terminal of PTK2
- Purification
- Affinity purified
- Immunogène
- PTK2 B antibody was raised using the C terminal of PTK2 corresponding to a region with amino acids KSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMEL
- Top Product
- Discover our top product PTK2B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PTK2B Blocking Peptide, catalog no. 33R-4661, is also available for use as a blocking control in assays to test for specificity of this PTK2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTK0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))
- Autre désignation
- PTK2B (PTK2B Produits)
- Synonymes
- anticorps CADTK, anticorps CAKB, anticorps FADK2, anticorps FAK2, anticorps PKB, anticorps PTK, anticorps PYK2, anticorps RAFTK, anticorps CAKbeta, anticorps E430023O05Rik, anticorps Raftk, anticorps Pyk2, anticorps fak1b, anticorps ptk2.2, anticorps ptk2b, anticorps si:ch1073-355e8.1, anticorps protein tyrosine kinase 2 beta, anticorps PTK2 protein tyrosine kinase 2 beta, anticorps protein tyrosine kinase 2aa, anticorps PTK2B, anticorps Ptk2b, anticorps ptk2aa
- Sujet
- PTK2B encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity.
- Poids moléculaire
- 116 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Cellular Glucan Metabolic Process, Cell-Cell Junction Organization, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Protein targeting to Nucleus, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Positive Regulation of fat Cell Differentiation, VEGF Signaling
-