PCDH12 anticorps (Middle Region)

N° du produit ABIN634683

Détail du produit anti-PCDH12 anticorps

Antigène: PCDH12 (Protocadherin 12 (PCDH12))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDH12 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDH12 antibody was raised against the middle region of PCDH12

Purification: Affinity purified

Immunogène: PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDH12 Blocking Peptide, catalog no. 33R-8846, is also available for use as a blocking control in assays to test for specificity of this PCDH12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDH12

Antigène: PCDH12 (Protocadherin 12 (PCDH12))

Autre désignation: PCDH12 (PCDH12 Produits)

Synonymes: anticorps PCDH12, anticorps VE-cadherin-2, anticorps VECAD2, anticorps Pcdh14, anticorps VE-cad-2, anticorps protocadherin 12, anticorps PCDH12, anticorps Pcdh12

Sujet: PCDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.

Poids moléculaire: 126 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process