Mesothelin anticorps (Middle Region)
-
- Antigène Voir toutes Mesothelin (MSLN) Anticorps
- Mesothelin (MSLN)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Mesothelin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Mesothelin antibody was raised against the middle region of MSLN
- Purification
- Affinity purified
- Immunogène
- Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids QKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVL
- Top Product
- Discover our top product MSLN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Mesothelin Blocking Peptide, catalog no. 33R-7609, is also available for use as a blocking control in assays to test for specificity of this Mesothelin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSLN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Mesothelin (MSLN)
- Autre désignation
- Mesothelin (MSLN Produits)
- Synonymes
- anticorps MPF, anticorps SMRP, anticorps MSLN, anticorps mesothelin, anticorps MSLN, anticorps Msln, anticorps LOC611363, anticorps LOC100524016
- Sujet
- An antibody that reacts with ovarian cancers and mesotheliomas was used to isolate a cell surface antigen named mesothelin. Although the function of mesothelin is unknown, it may play a role in cellular adhesion and is present on mesothelium, mesotheliomas, and ovarian cancers.
- Poids moléculaire
- 32 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process
-