Presenilin 1 anticorps (N-Term)
-
- Antigène Voir toutes Presenilin 1 (PSEN1) Anticorps
- Presenilin 1 (PSEN1)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Presenilin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Presenilin 1 antibody was raised against the N terminal of PSEN1
- Purification
- Affinity purified
- Immunogène
- Presenilin 1 antibody was raised using the N terminal of PSEN1 corresponding to a region with amino acids TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY
- Top Product
- Discover our top product PSEN1 Anticorps primaire
-
anti-Presenilin 1 (PSEN1) (AA 1-160) antibody
PSEN1 Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Presenilin 1 (PSEN1) (AA 330-359), (C-Term) antibodyPSEN1 Reactivité: Humain, Souris WB, IHC (p), IF, FACS Hôte: Lapin Polyclonal RB2257 unconjugated
anti-Presenilin 1 (PSEN1) (AA 4-218) antibodyPSEN1 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Presenilin 1 (PSEN1) (Middle Region) antibodyPSEN1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cobaye, Cheval, Chien, Lapin WB, IHC, IP Hôte: Lapin Polyclonal unconjugated
anti-Presenilin 1 (PSEN1) (AA 1-160) antibodyPSEN1 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Presenilin 1 (PSEN1) (AA 1-100) antibody (FITC)PSEN1 Reactivité: Humain, Souris WB, IHC Hôte: Lapin Polyclonal FITC
anti-Presenilin 1 (PSEN1) (AA 1-100) antibody (Alkaline Phosphatase (AP))PSEN1 Reactivité: Humain, Souris WB, IHC Hôte: Lapin Polyclonal Alkaline Phosphatase (AP)
anti-Presenilin 1 (PSEN1) (AA 100-200) antibody (Biotin)PSEN1 Reactivité: Humain, Souris, Rat WB, IHC Hôte: Lapin Polyclonal Biotin
anti-Presenilin 1 (PSEN1) (AA 100-200) antibody (PE)PSEN1 Reactivité: Humain, Souris, Rat WB, IHC Hôte: Lapin Polyclonal PE
anti-Presenilin 1 (PSEN1) (AA 1-100) antibody (APC)PSEN1 Reactivité: Humain, Souris WB, IHC Hôte: Lapin Polyclonal APC
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Presenilin 1 Blocking Peptide, catalog no. 33R-9260, is also available for use as a blocking control in assays to test for specificity of this Presenilin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSEN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Presenilin 1 (PSEN1)
- Autre désignation
- Presenilin 1 (PSEN1 Produits)
- Synonymes
- anticorps pre1, anticorps psen, anticorps zfPS1, anticorps zf-PS1, anticorps ad3, anticorps fad, anticorps ps1, anticorps s182, anticorps X-PS-beta, anticorps X-PS-alpha, anticorps AD3, anticorps FAD, anticorps PS-1, anticorps PS1, anticorps S182, anticorps Ad3h, anticorps presenilin 1, anticorps presenilin 1 L homeolog, anticorps psen1, anticorps PSEN1, anticorps Psen1, anticorps psen1.L
- Sujet
- Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1, PSEN2) or in the amyloid precursor protein (APP).
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- Signalisation Notch, EGFR Signaling Pathway, Synaptic Vesicle Exocytosis, Dicarboxylic Acid Transport
-
