SLC7A11 anticorps
-
- Antigène Voir toutes SLC7A11 Anticorps
- SLC7A11 (Solute Carrier Family 7, (Cationic Amino Acid Transporter, Y+ System) Member 11 (SLC7A11))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC7A11 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC7 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK
- Top Product
- Discover our top product SLC7A11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC7A11 Blocking Peptide, catalog no. 33R-4402, is also available for use as a blocking control in assays to test for specificity of this SLC7A11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC7A11 (Solute Carrier Family 7, (Cationic Amino Acid Transporter, Y+ System) Member 11 (SLC7A11))
- Autre désignation
- SLC7A11 (SLC7A11 Produits)
- Synonymes
- anticorps SLC7A11, anticorps DKFZp468E122, anticorps CCBR1, anticorps xCT, anticorps 9930009M05Rik, anticorps AI451155, anticorps sut, anticorps solute carrier family 7 member 11, anticorps solute carrier family 7, (cationic amino acid transporter, y+ system) member 11, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 11, anticorps SLC7A11, anticorps Slc7a11
- Sujet
- SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.
- Poids moléculaire
- 55 kDa (MW of target protein)
-