NTRK3 anticorps (C-Term)

N° du produit ABIN635695

Détail du produit anti-NTRK3 anticorps

Antigène: NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NTRK3 est non-conjugé

Application: Western Blotting (WB)

Specificité: NTRK3 antibody was raised against the C terminal of NTRK3

Purification: Affinity purified

Immunogène: NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NTRK3 Blocking Peptide, catalog no. 33R-2709, is also available for use as a blocking control in assays to test for specificity of this NTRK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTRK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NTRK3

Antigène: NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))

Autre désignation: NTRK3 (NTRK3 Produits)

Synonymes: anticorps TRKC, anticorps gp145(trkC), anticorps trkC, anticorps AW125844, anticorps Ntrk3_tv3, anticorps TrkC, anticorps neurotrophic receptor tyrosine kinase 3, anticorps neurotrophic tyrosine kinase, receptor, type 3, anticorps NTRK3, anticorps Ntrk3

Sujet: NTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.

Poids moléculaire: 89 kDa (MW of target protein)

Pathways: Signalisation RTK, Neurotrophin Signaling Pathway, Regulation of Cell Size