CYP3A4 anticorps (Middle Region)
-
- Antigène Voir toutes CYP3A4 Anticorps
- CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP3A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP3 A43 antibody was raised against the middle region of CYP3 43
- Purification
- Affinity purified
- Immunogène
- CYP3 A43 antibody was raised using the middle region of CYP3 43 corresponding to a region with amino acids ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII
- Top Product
- Discover our top product CYP3A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP3A43 Blocking Peptide, catalog no. 33R-2706, is also available for use as a blocking control in assays to test for specificity of this CYP3A43 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 43 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))
- Autre désignation
- CYP3A43 (CYP3A4 Produits)
- Synonymes
- anticorps CP33, anticorps CP34, anticorps CYP3A, anticorps CYP3A3, anticorps CYPIIIA3, anticorps CYPIIIA4, anticorps HLP, anticorps NF-25, anticorps P450C3, anticorps P450PCN1, anticorps MGC108372, anticorps CYP3A80, anticorps CYP3A4, anticorps CYP3A21, anticorps CYPIIIA21, anticorps CYP3A12, anticorps cytochrome P450 family 3 subfamily A member 4, anticorps cytochrome P450 family 3 subfamily A member 43, anticorps cytochrome P450 3A4, anticorps cytochrome P450, subfamily IIIA, polypeptide 4, anticorps cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4, anticorps cytochrome P450, family 3, subfamily A, polypeptide 4, anticorps CYP3A4, anticorps CYP3A43, anticorps PTRG_01782, anticorps PTRG_06060, anticorps cyp3a4
- Sujet
- CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1.
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-