WNT4 anticorps (Middle Region)

N° du produit ABIN636044

Détail du produit anti-WNT4 anticorps

Antigène: WNT4 (Wingless-Type MMTV Integration Site Family, Member 4 (WNT4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WNT4 est non-conjugé

Application: Western Blotting (WB)

Specificité: WNT4 antibody was raised against the middle region of WNT4

Purification: Affinity purified

Immunogène: WNT4 antibody was raised using the middle region of WNT4 corresponding to a region with amino acids HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WNT4 Blocking Peptide, catalog no. 33R-3744, is also available for use as a blocking control in assays to test for specificity of this WNT4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WNT4

Antigène: WNT4 (Wingless-Type MMTV Integration Site Family, Member 4 (WNT4))

Autre désignation: WNT4 (WNT4 Produits)

Synonymes: anticorps CG4698, anticorps DWnt-4, anticorps DWnt4, anticorps Dm DWnt4, anticorps Dmel\\CG4698, anticorps Dwnt4, anticorps Wnt, anticorps Wnt-4, anticorps anon-EST:Liang-2.4, anticorps clone 2.4, anticorps wnt-4, anticorps wnt4, anticorps SERKAL, anticorps WNT-4, anticorps Xwnt4, anticorps xwnt-4, anticorps zgc:136737, anticorps Wnt family member 4, anticorps Wnt oncogene analog 4, anticorps wingless-type MMTV integration site family, member 4, anticorps wingless-type MMTV integration site family member 4 S homeolog, anticorps wingless-type MMTV integration site family, member 4a, anticorps WNT4, anticorps Wnt4, anticorps wnt4.S, anticorps wnt4a

Sujet: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Signalisation WNT, Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, Cell-Cell Junction Organization, Tube Formation