anti-Rat (Rattus) SLC25A32 anticorps pour Western Blotting

Recommended SLC25A32 Antibody (fourni par: Connectez-vous pour afficher )

Solute Carrier Family 25, Member 32 (SLC25A32) Anticorps
  • fi40c12
  • mftc
  • wu:fi40c12
  • zgc:55610
  • zgc:110786
  • RGD1565789
  • MFT
  • MFTC
  • 2610043O12Rik
  • Mftc
  • solute carrier family 25 (mitochondrial folate carrier), member 32a
  • solute carrier family 25 (mitochondrial folate carrier), member 32b
  • NAD transporter
  • mitochondrial folate transporter/carrier
  • solute carrier family 25 member 32
  • solute carrier family 25 (mitochondrial folate carrier), member 32 L homeolog
  • solute carrier family 25, member 32
  • slc25a32a
  • slc25a32b
  • SJAG_04328
  • PAAG_07673
  • PAAG_03661
  • MCYG_01228
  • MGYG_01778
  • SLC25A32
  • Slc25a32
  • slc25a32.L
Middle Region
Humain, Souris, Rat (Rattus)
Cet anticorp SLC25A32 est non-conjugé
Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN635047
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
16.545948 ABIN635067 WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 0
15.2439375 ABIN2781692 WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 1
4.743937 ABIN2781693 WB Rabbit Middle Region Connectez-vous pour afficher Polyclonal 1
4.743937 ABIN2462769 ELISA WB Rabbit Connectez-vous pour afficher Polyclonal 0
4 ABIN225214 WB Rabbit IgG AA 21-70 Connectez-vous pour afficher Polyclonal 0
4 ABIN468943 WB Rabbit AA 215-264 Connectez-vous pour afficher Polyclonal 0


Antigène Solute Carrier Family 25, Member 32 (SLC25A32) Anticorps
Épitope Middle Region
(4), (2), (1), (1), (1)
Reactivité Humain, Souris, Rat (Rattus)
(12), (7), (6), (6), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (1), (1)
Hôte Lapin
Conjugué Cet anticorp SLC25A32 est non-conjugé
(1), (1), (1)
Application Western Blotting (WB)
(8), (5), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-SLC25A32 anticorps

Détail du antigène SLC25A32 Information d'application Stockage Images
Specificité SLC25 A32 antibody was raised against the middle region of SLC25 32
Purification Affinity purified
Immunogène SLC25 A32 antibody was raised using the middle region of SLC25 32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID
Plasmids, Primers & others

Détail du antigène SLC25A32

Détail du produit anti-SLC25A32 anticorps Information d'application Stockage Images Haut de la page
Autre désignation SLC25A32 (SLC25A32 Antibody Extrait)
Sujet SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria.
Poids moléculaire 35 kDa (MW of target protein)
Pathways Dicarboxylic Acid Transport

Information d'application

Détail du produit anti-SLC25A32 anticorps Détail du antigène SLC25A32 Stockage Images Haut de la page
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

SLC25A32 Blocking Peptide, catalog no. 33R-6857, is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Restrictions For Research Use only


Détail du produit anti-SLC25A32 anticorps Détail du antigène SLC25A32 Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Détail du produit anti-SLC25A32 anticorps Détail du antigène SLC25A32 Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Solute Carrier Family 25, Member 32 (SLC25A32) (Middle Region) antibody (ABIN635047) SLC25A32 antibody used at 1 ug/ml to detect target protein.