anti-Humain ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 anticorps pour Immunohistochemistry

Recommended ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) Anticorps
  • ABC21
  • GBD1
  • ICP3
  • MDR2
  • MDR2/3
  • MDR3
  • PFIC-3
  • PGY3
  • zgc:172149
  • Mdr2
  • Pgy-2
  • Pgy2
  • mdr-2
  • Pgy3
  • ABCB4a
  • Abcb4
  • Evi32
  • Mdr1a
  • Mdr3
  • P-gp
  • Pgp
  • Pgy-3
  • mdr-3
  • DEFB1
  • PGP3
  • ABCB4
  • RUNDC3B
  • ATP binding cassette subfamily B member 4
  • ATP-binding cassette, sub-family B (MDR/TAP), member 4
  • ATP-binding cassette, sub-family B (MDR/TAP), member 1A
  • beta-defensin 1-like
  • RUN domain-containing protein 3B
  • ABCB4
  • abcb4
  • Abcb4
  • Abcb1a
  • LOC100861170
  • LOC101122517
Reactivité
Humain
42
25
9
3
3
3
2
2
2
1
1
1
Hôte
Lapin
45
8
2
2
Clonalité
Polyclonal
Conjugué
Inconjugué
5
5
4
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
44
25
20
8
5
4
4
3
3
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4333373
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
8.540899 ABIN768867 IHC IHC (p) WB Rabbit AA 252-301 Connectez-vous pour afficher Polyclonal 0
8.540899 ABIN4333374 IHC IHC (p) Rabbit IgG Connectez-vous pour afficher Polyclonal 0
8.540899 ABIN3030051 IHC ELISA WB Rabbit Ig Fraction AA 624-654 Connectez-vous pour afficher Polyclonal 0
1 ABIN599903 FACS ICC IHC IHC (fro) WB Mouse IgG2b AA 629-692, Internal Region Connectez-vous pour afficher P3II-26 0
1 ABIN307268 ICC IHC IHC (fro) WB Mouse IgG2b AA 629-692 Connectez-vous pour afficher 0
1 ABIN2738049 IHC IHC (p) WB Rabbit IgG AA 601-720 Connectez-vous pour afficher Polyclonal 0
1 ABIN2193600 IHC ELISA WB Rabbit IgG AA 632-661, Center, Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN2193598 IHC ELISA WB FITC Rabbit IgG AA 632-661, Center, Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN2313191 IC IHC WB Rat IgG2a AA 372-431 Connectez-vous pour afficher 6D570 0
1 ABIN2193602 IHC ELISA WB PE Rabbit IgG AA 632-661, Center, Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN2193601 IHC ELISA WB HRP Rabbit IgG AA 632-661, Center, Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN2193596 IHC ELISA WB APC Rabbit IgG AA 632-661, Center, Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN2313197 IC IHC WB Rat IgG2a AA 372-431 Connectez-vous pour afficher 6D571 0
1 ABIN2313182 IC FACS IF IHC WB Mouse IgG1 AA 830-949 Connectez-vous pour afficher 6D568 0
1 ABIN6107058 ELISA IHC Rabbit IgG AA 530-693 Connectez-vous pour afficher Polyclonal 0
1 ABIN2193595 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 632-661, Center, Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN2193597 IHC ELISA WB Biotin Rabbit IgG AA 632-661, Center, Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN2313179 IHC Goat N-Term Connectez-vous pour afficher Polyclonal 0

General

Antigène ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) Anticorps
Reactivité Humain
(42), (25), (9), (3), (3), (3), (2), (2), (2), (1), (1), (1)
Hôte Lapin
(45), (8), (2), (2)
Clonalité
Polyclonal
Conjugué Inconjugué
(5), (5), (4), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(44), (25), (20), (8), (5), (4), (4), (3), (3), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQD
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Antigène
Autre désignation MDR3/ABCB4 (ABCB4 Antibody Extrait)
Sujet Gene Symbol: ABCB4
ID gène 5244
UniProt P21439
Pathways Regulation of Lipid Metabolism by PPARalpha

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody (ABIN4333373) Immunohistochemistry: MDR3/ABCB4 Antibody [NBP2-30876] - Human liver.
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody (ABIN4333373) Immunohistochemistry-Paraffin: MDR3/ABCB4 Antibody - Staining of human liver shows s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody (ABIN4333373) Immunohistochemistry-Paraffin: MDR3/ABCB4 Antibody - Staining in human liver and ske...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody (ABIN4333373) Immunohistochemistry-Paraffin: MDR3/ABCB4 Antibody - Staining of human liver shows w...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody (ABIN4333373) Immunohistochemistry-Paraffin: MDR3/ABCB4 Antibody - Staining of human skeletal musc...