LIFR anticorps (C-Term)
-
- Antigène Voir toutes LIFR Anticorps
- LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))
-
Épitope
- AA 863-899, C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LIFR est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.
- Séquence
- EWIKETFYPD IPNPENCKAL QFQKSVCEGS SALKTLE
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.
Gene Name: leukemia inhibitory factor receptor alpha
Protein Name: Leukemia inhibitory factor receptor - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product LIFR Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))
- Autre désignation
- LIFR (LIFR Produits)
- Synonymes
- anticorps A230075M04Rik, anticorps AW061234, anticorps LIF, anticorps CD118, anticorps LIF-R, anticorps SJS2, anticorps STWS, anticorps SWS, anticorps leukemia inhibitory factor receptor, anticorps LIF receptor alpha, anticorps leukemia inhibitory factor receptor alpha, anticorps Lifr, anticorps LOC397451, anticorps LIFR
- Sujet
-
LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.
Synonyms: CD118 antibody|CD118 antigen antibody|FLJ98106 antibody|FLJ99923 antibody|Leukemia inhibitory factor receptor alpha antibody|Leukemia inhibitory factor receptor antibody|LIF R antibody|LIF receptor antibody|LIF-R antibody|Lifr antibody|LIFR_HUMAN antibody|SJS2 antibody|STWS antibody|SWS antibody - ID gène
- 3977
- UniProt
- P42702
- Pathways
- Signalistation JAK/STAT, Growth Factor Binding
-