Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

AIF anticorps

AIFM1 Reactivité: Humain, Souris, Rat WB, IHC (p), ICC Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN4950058
  • Antigène Voir toutes AIF (AIFM1) Anticorps
    AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
    Reactivité
    • 100
    • 54
    • 52
    • 22
    • 9
    • 8
    • 7
    • 7
    • 7
    • 5
    • 4
    • 3
    • 3
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 88
    • 9
    • 2
    • 2
    Lapin
    Clonalité
    • 84
    • 16
    Polyclonal
    Conjugué
    • 66
    • 5
    • 5
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp AIF est non-conjugé
    Application
    • 88
    • 39
    • 36
    • 28
    • 24
    • 14
    • 13
    • 13
    • 11
    • 7
    • 5
    • 4
    • 2
    • 2
    • 2
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC)
    Purification
    Antigen affinity
    Immunogène
    Amino acids FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED of human AIF were used as the immunogen for the AIF antibody.
    Isotype
    IgG
    Top Product
    Discover our top product AIFM1 Anticorps primaire
  • Indications d'application
    Optimal dilution of the AIF antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,ICC: 0.5-1 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Stock
    -20 °C
    Stockage commentaire
    After reconstitution, the AIF antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène
    AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
    Autre désignation
    AIFM1 (AIFM1 Produits)
    Synonymes
    anticorps AIF, anticorps CMTX4, anticorps COWCK, anticorps COXPD6, anticorps PDCD8, anticorps CG7263, anticorps DmAIF, anticorps Dmel\\CG7263, anticorps GB16024, anticorps DDBDRAFT_0187853, anticorps DDBDRAFT_0191137, anticorps DDB_0187853, anticorps DDB_0191137, anticorps aif, anticorps pdcd8, anticorps AIFM1, anticorps PCD8, anticorps AIFsh2, anticorps Hq, anticorps Pdcd8, anticorps mAIF, anticorps Aif, anticorps zgc:91994, anticorps apoptosis inducing factor mitochondria associated 1, anticorps allograft inflammatory factor 1, anticorps Apoptosis inducing factor, anticorps apoptosis-inducing factor 1, mitochondrial, anticorps apoptosis inducing factor, anticorps apoptosis inducing factor, mitochondria associated 1, anticorps apoptosis-inducing factor, mitochondrion-associated, 1, anticorps apoptosis-inducing factor, mitochondrion-associated 1, anticorps AIFM1, anticorps AIF1, anticorps AIF, anticorps LOC412212, anticorps aif, anticorps aifm1, anticorps Aifm1
    Sujet
    Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.
    UniProt
    O95831
    Pathways
    Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, L'effet Warburg
Vous êtes ici:
Support technique