Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

PDPK1 anticorps

PDPK1 Reactivité: Humain, Souris, Rat WB, IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN4952109
  • Antigène Voir toutes PDPK1 Anticorps
    PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))
    Reactivité
    • 164
    • 116
    • 80
    • 11
    • 5
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 159
    • 21
    • 1
    Lapin
    Clonalité
    • 152
    • 29
    Polyclonal
    Conjugué
    • 82
    • 10
    • 9
    • 7
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Cet anticorp PDPK1 est non-conjugé
    Application
    • 140
    • 67
    • 53
    • 53
    • 27
    • 27
    • 12
    • 10
    • 8
    • 7
    • 7
    • 5
    • 3
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))
    Purification
    Antigen affinity
    Immunogène
    Amino acids YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ of human PDPK1 were used as the immunogen for the PDPK1 antibody.
    Isotype
    IgG
    Top Product
    Discover our top product PDPK1 Anticorps primaire
  • Indications d'application
    Optimal dilution of the PDPK1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Stock
    -20 °C
    Stockage commentaire
    After reconstitution, the PDPK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène
    PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))
    Autre désignation
    PDPK1 / 3-phosphoinositide-dependent protein kinase 1 (PDPK1 Produits)
    Synonymes
    anticorps pdpk1, anticorps MGC82080, anticorps PDK1, anticorps PDPK2, anticorps PRO0461, anticorps Pdk1, anticorps zgc:153787, anticorps 3'-phosphoinositide-dependent protein kinase 1, anticorps 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1, anticorps ATPDK1, anticorps AtPDK1, anticorps T32M21.110, anticorps T32M21_110, anticorps zgc:77318, anticorps 3-phosphoinositide dependent protein kinase 1, anticorps 3-phosphoinositide dependent protein kinase 1 L homeolog, anticorps 3-phosphoinositide dependent protein kinase-1, anticorps 3-phosphoinositide dependent protein kinase 1a, anticorps 3-phosphoinositide-dependent protein kinase 1, anticorps 3'-phosphoinositide-dependent protein kinase 1, anticorps 3-phosphoinositide dependent protein kinase 1b, anticorps PDPK1, anticorps pdpk1.L, anticorps pdpk1, anticorps Pdpk1, anticorps pdpk1a, anticorps LOC100380750, anticorps pdk-1, anticorps PDK1, anticorps pdpk1b
    Sujet
    3-phosphoinositide dependent protein kinase-1 is a protein which in humans is encoded by the PDPK1 gene. PDPK1 is a master kinase, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, SGK. An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling. Mice lacking PDPK1 die during early embryonic development, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development.
    UniProt
    O15530
    Pathways
    Signalisation PI3K-Akt, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Cell-Cell Junction Organization, Regulation of Cell Size, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals
Vous êtes ici:
Support technique