PDGFB anticorps (C-Term)

N° du produit ABIN5518861

Détail du produit anti-PDGFB anticorps

Antigène: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Épitope: AA 89-129, C-Term

Reactivité: Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDGFB est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Platelet-derived growth factor subunit B(PDGFB) detection. Tested with WB in Human,Mouse,Rat.

Séquence: AEPAMIAECK TRTEVFEISR RLIDRTNANF LVWPPCVEVQ R

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Platelet-derived growth factor subunit B(PDGFB) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: platelet derived growth factor subunit B
Protein Name: Platelet-derived growth factor subunit B

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PDGF beta (89-129aa AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-PDGFB (ABIN5518861)

Hong, Hong, Chen, Wang, Hong: "Investigation of the protective effect of erythropoietin on spinal cord injury in rats." dans: Experimental and therapeutic medicine, Vol. 2, Issue 5, pp. 837-841, (2012) (PubMed).

Wang, Leung, Xu: "Low-intensity ultrasound-induced cellular destruction and autophagy of nasopharyngeal carcinoma cells." dans: Experimental and therapeutic medicine, Vol. 2, Issue 5, pp. 849-852, (2011) (PubMed).

Détails sur PDGFB

Antigène: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Autre désignation: PDGFB (PDGFB Produits)

Synonymes: anticorps PDGF-2, anticorps PDGF2, anticorps SIS, anticorps SSV, anticorps c-sis, anticorps pdgf2, anticorps sis, anticorps si:ch211-79m20.1, anticorps si:dkey-261d11.1, anticorps PDGF-B, anticorps Sis, anticorps platelet derived growth factor subunit B, anticorps platelet-derived growth factor beta polypeptide, anticorps platelet derived growth factor subunit B S homeolog, anticorps platelet-derived growth factor beta polypeptide a, anticorps platelet derived growth factor, B polypeptide, anticorps PDGFB, anticorps pdgfb.S, anticorps pdgfba, anticorps Pdgfb

Sujet: Platelet-derived growth factor subunit B is a protein that in humans is encoded by the PDGFB gene. The protein encoded by this gene is a member of the platelet-derived growth factor family. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. This gene is mapped to 22q13.1. Growth factor plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. This gene plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

Synonyms: Becaplermin | PDGF2 | PDGF-2 | PDGF 2 | PDGF B chain | PDGF subunit B | Pdgfb | SIS | SSV | P01127

ID gène: 5155

UniProt: P01127

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling