NPC2 anticorps

N° du produit ABIN5693246

Détail du produit anti-NPC2 anticorps

Antigène: NPC2 (Niemann-Pick Disease, Type C2 (NPC2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NPC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Marque: Picoband™

Séquence: KSEYPSIKLV VEWQLQDDKN QSLFCWEIPV QIVS

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Niemann Pick C2 detection. Tested with WB, IHC-P in Human.

Immunogène: A synthetic peptide corresponding to a sequence of human Niemann Pick C2 (KSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVS).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot,0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section),0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur NPC2

Antigène: NPC2 (Niemann-Pick Disease, Type C2 (NPC2))

Autre désignation: NPC2 (NPC2 Produits)

Synonymes: anticorps 2700012J19Rik, anticorps AA408070, anticorps AU045843, anticorps HE1, anticorps EDDM1, anticorps re1, anticorps CE1, anticorps EPI-1, anticorps cb292, anticorps sb:cb292, anticorps NPC intracellular cholesterol transporter 2, anticorps Niemann-Pick disease, type C2, anticorps Npc2, anticorps NPC2, anticorps npc2

Sujet:

Synonyms: Epididymal secretory protein E1, Human epididymis-specific protein 1, He1, Niemann-Pick disease type C2 protein, NPC2, HE1

Tissue Specificity: Epididymis.

Background: NPC2 is a protein associated with Niemann-Pick disease, type C. This gene is mapped to chromosome 14q24.3. It encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.

UniProt: P61916

Pathways: SARS-CoV-2 Protein Interactome