PPP1CA anticorps (N-Term)
-
- Antigène Voir toutes PPP1CA Anticorps
- PPP1CA (Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP1CA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PPP1 CA antibody was raised against the N terminal of PPP1 A
- Purification
- Affinity purified
- Immunogène
- PPP1 CA antibody was raised using the N terminal of PPP1 A corresponding to a region with amino acids MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC
- Top Product
- Discover our top product PPP1CA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPP1CA Blocking Peptide, catalog no. 33R-6411, is also available for use as a blocking control in assays to test for specificity of this PPP1CA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 A antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPP1CA (Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA))
- Autre désignation
- PPP1CA (PPP1CA Produits)
- Synonymes
- anticorps PP-1A, anticorps PP1A, anticorps PP1alpha, anticorps PPP1A, anticorps Ppp1c, anticorps dism2, anticorps ppp1a, anticorps wu:fc04c08, anticorps wu:fc09b07, anticorps wu:fc30g11, anticorps wu:fe05h08, anticorps zgc:85729, anticorps Ppp1ca, anticorps fb18b03, anticorps fd20h04, anticorps wu:fb18b03, anticorps wu:fd20h04, anticorps wu:fl22a03, anticorps zgc:55744, anticorps zgc:76940, anticorps protein phosphatase 1 catalytic subunit alpha, anticorps protein phosphatase 1, catalytic subunit, alpha isoform, anticorps protein phosphatase 1, catalytic subunit, alpha isozyme L homeolog, anticorps protein phosphatase 1, catalytic subunit, alpha isozyme, anticorps protein phosphatase 1, catalytic subunit, alpha isozyme a, anticorps protein phosphatase 1, catalytic subunit, alpha isozyme b, anticorps PPP1CA, anticorps Ppp1ca, anticorps ppp1ca.L, anticorps ppp1ca, anticorps ppp1caa, anticorps ppp1cab
- Sujet
- PPP1CA is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory.
- Poids moléculaire
- 38 kDa (MW of target protein)
- Pathways
- M Phase, Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process, Lipid Metabolism
-