PPP3CA anticorps
-
- Antigène Voir toutes PPP3CA Anticorps
- PPP3CA (Protein Phosphatase 3, Catalytic Subunit, alpha Isoform (PPP3CA))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP3CA est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PPP3 CA antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE
- Top Product
- Discover our top product PPP3CA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPP3CA Blocking Peptide, catalog no. 33R-5289, is also available for use as a blocking control in assays to test for specificity of this PPP3CA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 A antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPP3CA (Protein Phosphatase 3, Catalytic Subunit, alpha Isoform (PPP3CA))
- Autre désignation
- PPP3CA (PPP3CA Produits)
- Synonymes
- anticorps CALN, anticorps CALNA, anticorps CALNA1, anticorps CCN1, anticorps CNA1, anticorps PPP2B, anticorps 2900074D19Rik, anticorps AI841391, anticorps AW413465, anticorps CN, anticorps Caln, anticorps Calna, anticorps CnA, anticorps Calna1, anticorps calcineurin, anticorps caln, anticorps calna, anticorps calna1, anticorps ccn1, anticorps cna1, anticorps ppp2b, anticorps fj46e08, anticorps si:dkeyp-79c2.2, anticorps wu:fj46e08, anticorps ppp3ca, anticorps protein phosphatase 3 catalytic subunit alpha, anticorps protein phosphatase 3, catalytic subunit, alpha isoform, anticorps protein phosphatase 3, catalytic subunit, alpha isozyme, anticorps protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform (calcineurin A alpha), anticorps protein phosphatase 3, catalytic subunit, alpha isozyme L homeolog, anticorps serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform, anticorps PPP3CA, anticorps Ppp3ca, anticorps ppp3ca, anticorps ppp3ca.L, anticorps LOC100205420
- Sujet
- PPP3CA belongs to the PPP phosphatase family, PP-2B subfamily. It is a calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. PPP3CA dephosphorylates HSPB1 and SSH1.
- Poids moléculaire
- 59 kDa (MW of target protein)
- Pathways
- Signalisation RTK, Signalisation WNT, Fc-epsilon Receptor Signaling Pathway, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Synaptic Membrane, Skeletal Muscle Fiber Development, Protein targeting to Nucleus, VEGF Signaling, BCR Signaling
-