POLB anticorps

N° du produit ABIN634154

Détail du produit anti-POLB anticorps

Antigène: POLB (Polymerase (DNA Directed), beta (POLB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLB est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: POLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLB Blocking Peptide, catalog no. 33R-3482, is also available for use as a blocking control in assays to test for specificity of this POLB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLB

Antigène: POLB (Polymerase (DNA Directed), beta (POLB))

Autre désignation: POLB (POLB Produits)

Synonymes: anticorps wu:fa97a05, anticorps zgc:109924, anticorps POLB, anticorps DDBDRAFT_0186152, anticorps DDBDRAFT_0215784, anticorps DDBDRAFT_0232376, anticorps DDB_0186152, anticorps DDB_0215784, anticorps DDB_0232376, anticorps A430088C08Rik, anticorps polymerase (DNA directed), beta, anticorps DNA polymerase beta, anticorps DNA polymerase X family protein, anticorps polymerase (DNA directed), beta S homeolog, anticorps polb, anticorps POLB, anticorps polB, anticorps polb.S, anticorps Polb

Sujet: In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Réparation de l'ADN