KHDRBS1 anticorps (N-Term)

N° du produit ABIN634247

Détail du produit anti-KHDRBS1 anticorps

Antigène: KHDRBS1 (KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KHDRBS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KHDRBS1 antibody was raised against the N terminal of KHDRBS1

Purification: Affinity purified

Immunogène: KHDRBS1 antibody was raised using the N terminal of KHDRBS1 corresponding to a region with amino acids LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KHDRBS1 Blocking Peptide, catalog no. 33R-5263, is also available for use as a blocking control in assays to test for specificity of this KHDRBS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KHDRBS1

Antigène: KHDRBS1 (KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1))

Autre désignation: KHDRBS1 (KHDRBS1 Produits)

Synonymes: anticorps Sam68, anticorps p62, anticorps p68, anticorps fj90g10, anticorps khdrbs1, anticorps wu:fa18g12, anticorps wu:fa56c01, anticorps wu:fc91b01, anticorps wu:fj90g10, anticorps zgc:113899, anticorps KHDRBS1, anticorps P62, anticorps khdrbs1l, anticorps sb:cb97, anticorps wu:fb07d11, anticorps wu:fi43c05, anticorps zgc:85948, anticorps KH RNA binding domain containing, signal transduction associated 1, anticorps KH domain containing, RNA binding, signal transduction associated 1a, anticorps KH domain containing, RNA binding, signal transduction associated 1, anticorps KH domain containing, RNA binding, signal transduction associated 1 S homeolog, anticorps KH domain containing, RNA binding, signal transduction associated 1b, anticorps KHDRBS1, anticorps khdrbs1a, anticorps khdrbs1, anticorps Khdrbs1, anticorps khdrbs1.S, anticorps khdrbs1b

Sujet: KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Neurotrophin Signaling Pathway, Autophagy