PTPN1 anticorps (Middle Region)

N° du produit ABIN635198

Détail du produit anti-PTPN1 anticorps

Antigène: PTPN1 (Protein tyrosine Phosphatase, Non-Receptor Type 1 (PTPN1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTPN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PTPN1 antibody was raised against the middle region of PTPN1

Purification: Affinity purified

Immunogène: PTPN1 antibody was raised using the middle region of PTPN1 corresponding to a region with amino acids SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTPN1 Blocking Peptide, catalog no. 33R-8491, is also available for use as a blocking control in assays to test for specificity of this PTPN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTPN1

Antigène: PTPN1 (Protein tyrosine Phosphatase, Non-Receptor Type 1 (PTPN1))

Autre désignation: PTPN1 (PTPN1 Produits)

Synonymes: anticorps PTPN1, anticorps PTP1B, anticorps PTP-1B, anticorps PTP-HA2, anticorps Ptp, anticorps ptp1b, anticorps wu:fk54h03, anticorps CPTP1, anticorps protein tyrosine phosphatase, non-receptor type 1, anticorps protein tyrosine phosphatase, non-receptor type 1 L homeolog, anticorps PTPN1, anticorps Ptpn1, anticorps ptpn1, anticorps ptpn1.L

Sujet: PTPN1 is the founding member of the protein tyrosine phosphatase (PTP) family. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Signalisation TLR, Response to Growth Hormone Stimulus, ER-Nucleus Signaling, Platelet-derived growth Factor Receptor Signaling