ACVR2B anticorps (Middle Region)
-
- Antigène Voir toutes ACVR2B Anticorps
- ACVR2B (Activin A Receptor, Type IIB (ACVR2B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACVR2B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACVR2 B antibody was raised against the middle region of ACVR2
- Purification
- Affinity purified
- Immunogène
- ACVR2 B antibody was raised using the middle region of ACVR2 corresponding to a region with amino acids LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV
- Top Product
- Discover our top product ACVR2B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACVR2B Blocking Peptide, catalog no. 33R-4822, is also available for use as a blocking control in assays to test for specificity of this ACVR2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACVR2B (Activin A Receptor, Type IIB (ACVR2B))
- Autre désignation
- ACVR2B (ACVR2B Produits)
- Synonymes
- anticorps ACVR2B, anticorps XAR1, anticorps actr-iib, anticorps actriib, anticorps ACTRIIB, anticorps ActR-IIB, anticorps HTX4, anticorps ActRIIB, anticorps actr2b, anticorps actrIIb, anticorps wu:fj97d11, anticorps activin A receptor type 2B, anticorps activin A receptor type 2B L homeolog, anticorps activin A receptor type 2Ba, anticorps activin receptor IIB, anticorps ACVR2B, anticorps acvr2b, anticorps acvr2b.L, anticorps Acvr2b, anticorps acvr2ba
- Sujet
- Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity.
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- Hormone Transport, Cancer Immune Checkpoints
-