LIFR anticorps (Leukemia Inhibitory Factor Receptor alpha)

Details for Product anti-LIFR Antibody No. ABIN4951612
Antigène
  • A230075M04Rik
  • AW061234
  • LIF
  • CD118
  • LIF-R
  • SJS2
  • STWS
  • SWS
  • leukemia inhibitory factor receptor
  • LIF receptor alpha
  • leukemia inhibitory factor receptor alpha
  • Lifr
  • LOC397451
  • LIFR
Reactivité
Humain
56
27
24
1
1
1
1
1
Hôte
Lapin
88
8
Clonalité
Polyclonal
Conjugué
Cet anticorp LIFR est non-conjugé
17
7
1
1
1
1
1
1
1
Application
Western Blotting (WB)
71
37
34
13
9
9
3
2
2
1
Options
Immunogène Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others LIFR products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation LIF Receptor / LIFR (LIFR Antibody Extrait)
Sujet LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.
UniProt P42702
Pathways Signalistation JAK/STAT, Growth Factor Binding
Indications d'application Optimal dilution of the LIFR antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the LIFR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Leukemia Inhibitory Factor Receptor alpha (LIFR) antibody (ABIN4951612) Western blot testing of human 1) SW620, 2) COLO320 and 3) HepG2 cell lysate with LIFR...
Avez-vous cherché autre chose?