LIFR anticorps

N° du produit ABIN4951612

Détail du produit anti-LIFR anticorps

Antigène: LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIFR est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the LIFR antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the LIFR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur LIFR

Antigène: LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))

Autre désignation: LIF Receptor / LIFR (LIFR Produits)

Synonymes: anticorps A230075M04Rik, anticorps AW061234, anticorps LIF, anticorps CD118, anticorps LIF-R, anticorps SJS2, anticorps STWS, anticorps SWS, anticorps leukemia inhibitory factor receptor, anticorps LIF receptor alpha, anticorps leukemia inhibitory factor receptor alpha, anticorps Lifr, anticorps LOC397451, anticorps LIFR

Sujet: LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.

UniProt: P42702

Pathways: Signalistation JAK/STAT, Growth Factor Binding