LIFR anticorps
-
- Antigène Voir toutes LIFR Anticorps
- LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LIFR est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogène
- Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody.
- Isotype
- IgG
- Top Product
- Discover our top product LIFR Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the LIFR antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the LIFR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))
- Autre désignation
- LIF Receptor / LIFR (LIFR Produits)
- Synonymes
- anticorps A230075M04Rik, anticorps AW061234, anticorps LIF, anticorps CD118, anticorps LIF-R, anticorps SJS2, anticorps STWS, anticorps SWS, anticorps leukemia inhibitory factor receptor, anticorps LIF receptor alpha, anticorps leukemia inhibitory factor receptor alpha, anticorps Lifr, anticorps LOC397451, anticorps LIFR
- Sujet
- LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.
- UniProt
- P42702
- Pathways
- Signalistation JAK/STAT, Growth Factor Binding
-