Insulin anticorps

N° du produit ABIN6290122

Détail du produit anti-Insulin anticorps

Antigène: Insulin (INS)

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp Insulin est non-conjugé

Application: Western Blotting (WB)

Séquence: MFVNQHLCGS HLVEALYLVC GERGFFYTPK TGIVEQCCTS ICSLYQLENY CN

Specificité: Gives a positive signal using MBP-Insulin recombinant fusion protein by WB.

Purification: This antibody is epitope-affinity purified from goat antiserum.

Immunogène: Recombinant human Insulin (MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN) produced in E. coli as a fusion protein.

Isotype: IgG

Information d'application

Indications d'application: Western blot 1:250-1:2,000 Immunofluorescence ND Immunohistochemistry (paraffin) ND Immunohistochemistry (frozen) ND

Restrictions: For Research Use only

Stockage

Concentration: 3 mg/mL

Buffer: PBS, 20 % glycerol and 0.05 % sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: Store at -20°C, and avoid repeated freeze-thaw cycles.

Détails sur Insulin

Antigène: Insulin (INS)

Autre désignation: INS (INS Produits)

Synonymes: anticorps IDDM2, anticorps ILPR, anticorps IRDN, anticorps MODY10, anticorps ins1, anticorps xins, anticorps ins1-a, anticorps Insulin, anticorps AA986540, anticorps Ins-2, anticorps InsII, anticorps Mody, anticorps Mody4, anticorps proinsulin, anticorps zgc:109842, anticorps igf2-A, anticorps ins, anticorps ins-a, anticorps ins-b, anticorps insulin, anticorps insulin precursor, anticorps insulin II, anticorps preproinsulin, anticorps insulin L homeolog, anticorps insulin S homeolog, anticorps INS, anticorps INS-IGF2, anticorps ins, anticorps Ins, anticorps PIN, anticorps Ins2, anticorps ins.L, anticorps ins.S

Sujet: Goat polyclonal to Insulin. Insulin is a 6 kDa peptide, first synthesized as a precursor molecule, preproinsulin which is then processed into proinsulin and finally to the mature insulin. An increase in blood glucose levels during stimulates insulin release from pancreatic β cells. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake.

Poids moléculaire: 12 kDa

ID gène: 3630

UniProt: P01308

Pathways: Signalisation NF-kappaB, Signalisation RTK, Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, Hormone Activity, Carbohydrate Homeostasis, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Autophagy, Negative Regulation of intrinsic apoptotic Signaling, Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation