PRKACA anticorps (N-Term)

N° du produit ABIN633167

Détail du produit anti-PRKACA anticorps

Antigène: PRKACA (Protein Kinase A, alpha (PRKACA))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKACA est non-conjugé

Application: Western Blotting (WB)

Specificité: PRKACA antibody was raised against the N terminal of PRKACA

Purification: Affinity purified

Immunogène: PRKACA antibody was raised using the N terminal of PRKACA corresponding to a region with amino acids MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKACA Blocking Peptide, catalog no. 33R-5754, is also available for use as a blocking control in assays to test for specificity of this PRKACA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKACA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRKACA

Antigène: PRKACA (Protein Kinase A, alpha (PRKACA))

Autre désignation: PRKACA (PRKACA Produits)

Synonymes: anticorps PKACA, anticorps Calpha, anticorps Cs-PKA, anticorps PKCA1, anticorps PKA, anticorps PKCD, anticorps Pkaca, anticorps zgc:158799, anticorps protein kinase cAMP-activated catalytic subunit alpha, anticorps protein kinase, cAMP dependent, catalytic, alpha, anticorps cAMP-dependent protein kinase catalytic subunit, anticorps protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a, anticorps PRKACA, anticorps Prkaca, anticorps kin-1, anticorps prkacaa

Sujet: CAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Signalisation Hedgehog, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, Carbohydrate Homeostasis, Myometrial Relaxation and Contraction, M Phase, G-protein mediated Events, Signaling Events mediated by VEGFR1 and VEGFR2, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGFR1 Specific Signals, Lipid Metabolism, SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2