PCSK5 anticorps (Middle Region)

N° du produit ABIN633925

Détail du produit anti-PCSK5 anticorps

Antigène: PCSK5 (Proprotein Convertase Subtilisin/kexin Type 5 (PCSK5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCSK5 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCSK5 antibody was raised against the middle region of PCSK5

Purification: Affinity purified

Immunogène: PCSK5 antibody was raised using the middle region of PCSK5 corresponding to a region with amino acids CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCSK5 Blocking Peptide, catalog no. 33R-1642, is also available for use as a blocking control in assays to test for specificity of this PCSK5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCSK5

Antigène: PCSK5 (Proprotein Convertase Subtilisin/kexin Type 5 (PCSK5))

Autre désignation: PCSK5 (PCSK5 Produits)

Synonymes: anticorps PC5, anticorps PC6, anticorps PC6A, anticorps SPC6, anticorps subtilase, anticorps PC5/6A, anticorps PC5A, anticorps b2b1549Clo, anticorps b2b585Clo, anticorps Pc5, anticorps fur2, anticorps spc6, anticorps spc6A, anticorps MGC98915, anticorps PCSK5, anticorps pc6, anticorps spc6a, anticorps pcsk5, anticorps zgc:165659, anticorps proprotein convertase subtilisin/kexin type 5, anticorps proprotein convertase subtilisin/kexin type 5 S homeolog, anticorps proprotein convertase subtilisin/kexin type 5b, anticorps PCSK5, anticorps Pcsk5, anticorps pcsk5.S, anticorps LOC528098, anticorps pcsk5, anticorps pcsk5b

Sujet: PCSK5 belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. PCSK5 mediates posttranslational endoproteolytic processing for several integrin alpha subunits. It is thought to process prorenin, pro-membrane type-1 matrix metalloproteinase and HIV-1 glycoprotein gp160. Two alternatively spliced transcripts are described for this gene but only one has its full length nature known.

Poids moléculaire: 89 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway, Regulation of Systemic Arterial Blood Pressure by Hormones