ERK1 anticorps (Middle Region)

N° du produit ABIN634146

Cet anticorps anti-ERK1 Polyclonal Lapin (ABIN634146) détecte spécifiquement ERK1 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ERK1 anticorps (Middle Region) (ABIN634146)

Antigène: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ERK1 anticorps

Épitope: Middle Region

Specificité: MAPK3 antibody was raised against the middle region of MAPK3

Purification: Affinity purified

Immunogène: MAPK3 antibody was raised using the middle region of MAPK3 corresponding to a region with amino acids LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAPK3 Blocking Peptide, (ABIN940244), is also available for use as a blocking control in assays to test for specificity of this MAPK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERK1

Antigène: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Autre désignation: MAPK3

Sujet: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation and differentiation.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Signalisation MAPK, Signalisation RTK, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins