Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

ERK1 anticorps (Middle Region)

MAPK3 Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN634146
  • Antigène Voir toutes ERK1 (MAPK3) Anticorps
    ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
    Épitope
    • 73
    • 50
    • 20
    • 17
    • 16
    • 15
    • 15
    • 11
    • 11
    • 9
    • 9
    • 8
    • 6
    • 5
    • 5
    • 5
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reactivité
    • 221
    • 169
    • 137
    • 45
    • 20
    • 19
    • 17
    • 12
    • 11
    • 10
    • 10
    • 7
    • 7
    • 6
    • 5
    • 4
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 232
    • 26
    • 3
    • 1
    • 1
    Lapin
    Clonalité
    • 217
    • 46
    Polyclonal
    Conjugué
    • 107
    • 21
    • 20
    • 17
    • 9
    • 9
    • 7
    • 7
    • 7
    • 7
    • 7
    • 7
    • 5
    • 5
    • 5
    • 5
    • 5
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    Cet anticorp ERK1 est non-conjugé
    Application
    • 218
    • 91
    • 74
    • 68
    • 65
    • 43
    • 40
    • 37
    • 27
    • 20
    • 18
    • 12
    • 12
    • 5
    • 3
    • 2
    • 1
    • 1
    Western Blotting (WB)
    Specificité
    MAPK3 antibody was raised against the middle region of MAPK3
    Purification
    Affinity purified
    Immunogène
    MAPK3 antibody was raised using the middle region of MAPK3 corresponding to a region with amino acids LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
    Top Product
    Discover our top product MAPK3 Anticorps primaire
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    MAPK3 Blocking Peptide, catalog no. 33R-4858, is also available for use as a blocking control in assays to test for specificity of this MAPK3 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK3 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
    Autre désignation
    MAPK3 (MAPK3 Produits)
    Synonymes
    anticorps ERK-1, anticorps ERK1, anticorps ERT2, anticorps HS44KDAP, anticorps HUMKER1A, anticorps P44ERK1, anticorps P44MAPK, anticorps PRKM3, anticorps p44-ERK1, anticorps p44-MAPK, anticorps Erk-1, anticorps Erk1, anticorps Ert2, anticorps Esrk1, anticorps Mnk1, anticorps Mtap2k, anticorps Prkm3, anticorps p44, anticorps p44erk1, anticorps p44mapk, anticorps ERK3, anticorps ERK6, anticorps P38GAMMA, anticorps PRKM12, anticorps SAPK-3, anticorps SAPK3, anticorps fi06b09, anticorps wu:fi06b09, anticorps zERK1, anticorps Tb08.10J17.940, anticorps MAPK1, anticorps MNK1, anticorps AW123708, anticorps Erk6, anticorps P38gamma, anticorps Prkm12, anticorps Sapk3, anticorps ATMAPK3, anticorps ATMPK3, anticorps T6D9.4, anticorps mitogen-activated protein kinase 3, anticorps mitogen-activated protein kinase 3, anticorps mitogen-activated protein kinase 12, anticorps mitogen activated protein kinase 3, anticorps mitogen-activated serine/threonine-protein kinase, anticorps MAPK3, anticorps Mapk3, anticorps MAPK12, anticorps mapk3, anticorps Tc00.1047053509475.10, anticorps Tb927.8.3550, anticorps Mapk12, anticorps CEK1, anticorps MPK3
    Sujet
    The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation and differentiation.
    Poids moléculaire
    43 kDa (MW of target protein)
    Pathways
    Signalisation MAPK, Signalisation RTK, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins
Vous êtes ici:
Support technique