ERK1 anticorps (Middle Region)
-
- Antigène Voir toutes ERK1 (MAPK3) Anticorps
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ERK1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAPK3 antibody was raised against the middle region of MAPK3
- Purification
- Affinity purified
- Immunogène
- MAPK3 antibody was raised using the middle region of MAPK3 corresponding to a region with amino acids LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
- Top Product
- Discover our top product MAPK3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAPK3 Blocking Peptide, catalog no. 33R-4858, is also available for use as a blocking control in assays to test for specificity of this MAPK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
- Autre désignation
- MAPK3 (MAPK3 Produits)
- Synonymes
- anticorps ERK-1, anticorps ERK1, anticorps ERT2, anticorps HS44KDAP, anticorps HUMKER1A, anticorps P44ERK1, anticorps P44MAPK, anticorps PRKM3, anticorps p44-ERK1, anticorps p44-MAPK, anticorps Erk-1, anticorps Erk1, anticorps Ert2, anticorps Esrk1, anticorps Mnk1, anticorps Mtap2k, anticorps Prkm3, anticorps p44, anticorps p44erk1, anticorps p44mapk, anticorps ERK3, anticorps ERK6, anticorps P38GAMMA, anticorps PRKM12, anticorps SAPK-3, anticorps SAPK3, anticorps fi06b09, anticorps wu:fi06b09, anticorps zERK1, anticorps Tb08.10J17.940, anticorps MAPK1, anticorps MNK1, anticorps AW123708, anticorps Erk6, anticorps P38gamma, anticorps Prkm12, anticorps Sapk3, anticorps ATMAPK3, anticorps ATMPK3, anticorps T6D9.4, anticorps mitogen-activated protein kinase 3, anticorps mitogen-activated protein kinase 3, anticorps mitogen-activated protein kinase 12, anticorps mitogen activated protein kinase 3, anticorps mitogen-activated serine/threonine-protein kinase, anticorps MAPK3, anticorps Mapk3, anticorps MAPK12, anticorps mapk3, anticorps Tc00.1047053509475.10, anticorps Tb927.8.3550, anticorps Mapk12, anticorps CEK1, anticorps MPK3
- Sujet
- The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation and differentiation.
- Poids moléculaire
- 43 kDa (MW of target protein)
- Pathways
- Signalisation MAPK, Signalisation RTK, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins
-