anti-Humain ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) Anticorps
  • ABC21
  • GBD1
  • ICP3
  • MDR2
  • MDR2/3
  • MDR3
  • PFIC-3
  • PGY3
  • zgc:172149
  • Mdr2
  • Pgy-2
  • Pgy2
  • mdr-2
  • Pgy3
  • ABCB4a
  • Abcb4
  • Evi32
  • Mdr1a
  • Mdr3
  • P-gp
  • Pgp
  • Pgy-3
  • mdr-3
  • DEFB1
  • PGP3
  • ABCB4
  • RUNDC3B
  • ATP binding cassette subfamily B member 4
  • ATP-binding cassette, sub-family B (MDR/TAP), member 4
  • ATP-binding cassette, sub-family B (MDR/TAP), member 1A
  • beta-defensin 1-like
  • RUN domain-containing protein 3B
  • ABCB4
  • abcb4
  • Abcb4
  • Abcb1a
  • LOC100861170
  • LOC101122517
Reactivité
Humain
42
25
9
3
3
3
2
2
2
1
1
1
Hôte
Lapin
45
8
2
2
Clonalité
Polyclonal
Conjugué
Inconjugué
5
5
4
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
44
25
20
8
5
4
4
3
3
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4333373
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
10.877876 ABIN4333372 IHC (p) Goat N-Term, all Isoforms Connectez-vous pour afficher Polyclonal 0
1 ABIN3043734 IHC (p) WB Rabbit IgG AA 601-720 Connectez-vous pour afficher Polyclonal 0
1 ABIN390060 IHC (p) WB Rabbit Ig Fraction AA 624-654, Center Connectez-vous pour afficher Polyclonal 2
1 ABIN768867 IHC IHC (p) WB Rabbit AA 252-301 Connectez-vous pour afficher Polyclonal 0
1 ABIN358591 EIA IHC (p) WB Rabbit Ig Fraction Center Connectez-vous pour afficher Polyclonal 0
1 ABIN4333374 IHC IHC (p) Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2738049 IHC IHC (p) WB Rabbit IgG AA 601-720 Connectez-vous pour afficher Polyclonal 0
1 ABIN3028483 FACS IHC (p) WB Rabbit IgG AA 601-720 Connectez-vous pour afficher Polyclonal 0

General

Antigène ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) Anticorps
Reactivité Humain
(42), (25), (9), (3), (3), (3), (2), (2), (2), (1), (1), (1)
Hôte Lapin
(45), (8), (2), (2)
Clonalité
Polyclonal
Conjugué Inconjugué
(5), (5), (4), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(44), (25), (20), (8), (5), (4), (4), (3), (3), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQD
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Antigène
Autre désignation MDR3/ABCB4 (ABCB4 Antibody Extrait)
Sujet Gene Symbol: ABCB4
ID gène 5244
UniProt P21439
Pathways Regulation of Lipid Metabolism by PPARalpha

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody (ABIN4333373) Immunohistochemistry: MDR3/ABCB4 Antibody [NBP2-30876] - Human liver.
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody (ABIN4333373) Immunohistochemistry-Paraffin: MDR3/ABCB4 Antibody - Staining of human liver shows s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody (ABIN4333373) Immunohistochemistry-Paraffin: MDR3/ABCB4 Antibody - Staining in human liver and ske...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody (ABIN4333373) Immunohistochemistry-Paraffin: MDR3/ABCB4 Antibody - Staining of human liver shows w...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody (ABIN4333373) Immunohistochemistry-Paraffin: MDR3/ABCB4 Antibody - Staining of human skeletal musc...