PTPN11 anticorps (N-Term)

N° du produit ABIN3043912

Détail du produit anti-PTPN11 anticorps

Antigène: PTPN11 (Protein tyrosine Phosphatase, Non-Receptor Type 11 (PTPN11))

Épitope: AA 69-99, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTPN11 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 11(PTPN11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: EKFATLAELV QYYMEHHGQL KEKNGDVIEL K

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 11(PTPN11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein tyrosine phosphatase, non-receptor type 11
Protein Name: Tyrosine-protein phosphatase non-receptor type 11

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PTPN11

Antigène: PTPN11 (Protein tyrosine Phosphatase, Non-Receptor Type 11 (PTPN11))

Autre désignation: PTPN11 (PTPN11 Produits)

Synonymes: anticorps BPTP3, anticorps CFC, anticorps NS1, anticorps PTP-1D, anticorps PTP2C, anticorps SH-PTP2, anticorps SH-PTP3, anticorps SHP2, anticorps 2700084A17Rik, anticorps AW536184, anticorps PTP1D, anticorps SAP-2, anticorps SHP-2, anticorps Shp2, anticorps Syp, anticorps SYP, anticorps bptp3, anticorps cfc, anticorps ns1, anticorps ptp-2, anticorps ptp2c, anticorps ptpn11, anticorps ptpn11-a, anticorps ptpn11-b, anticorps shp-2, anticorps shp2, anticorps fa14b09, anticorps wu:fa14b09, anticorps wu:fi24f03, anticorps zgc:55388, anticorps zgc:63553, anticorps protein tyrosine phosphatase, non-receptor type 11, anticorps protein tyrosine phosphatase, non-receptor type 11 S homeolog, anticorps protein tyrosine phosphatase, non-receptor type 11, a, anticorps protein tyrosine phosphatase, non-receptor type 11, b, anticorps PTPN11, anticorps Ptpn11, anticorps ptpn11.S, anticorps ptpn11a, anticorps ptpn11b

Classe de substances: Viral Protein

Sujet: PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1,779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.

Synonyms: BPTP 3 antibody|BPTP3 antibody|CFC antibody|MGC14433 antibody|Noonan syndrome 1 antibody|Noonan syndrome 1 protein tyrosine phosphatase 2C antibody|NS 1 antibody|NS1 antibody|OTTHUMP00000166107 antibody|OTTHUMP00000166108 antibody|Protein tyrosine phosphatase 2 antibody|Protein tyrosine phosphatase 2C antibody|Protein Tyrosine Phosphatase Non receptor Type 11 antibody|Protein-tyrosine phosphatase 1D antibody|Protein-tyrosine phosphatase 2C antibody|PTN11_HUMAN antibody|PTP 1D antibody|PTP 2C antibody|PTP-1D antibody|PTP-2C antibody|PTP1D antibody|PTP2C antibody|PTPN 11 antibody|PTPN11 antibody|PTPN11 antibody|SAP2 antibody|SH PTP2 antibody|SH PTP3 antibody|SH-PTP2 antibody|SH-PTP3 antibody|SH2 domain containing protein tyrosine phosphatase 2 antibody|SHIP2 antibody|SHP 2 antibody|SHP-2 antibody|Shp2 antibody|SHPTP 2 antibody|SHPTP2 antibody|SHPTP3 antibody|SIT protein precursor antibody| Syp antibody|Tyrosine protein phosphatase non receptor type 11 antibody|Tyrosine-protein phosphatase non-receptor type 11 antibody

ID gène: 5781

UniProt: Q06124

Pathways: Signalistation JAK/STAT, Signalisation RTK, TCR Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Toll-Like Receptors Cascades, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, BCR Signaling, L'effet Warburg