PKC zeta anticorps (N-Term)

N° du produit ABIN631227

Détail du produit anti-PKC zeta anticorps

Antigène: PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PKC zeta est non-conjugé

Application: Western Blotting (WB)

Specificité: PRKCZ antibody was raised against the N terminal of PRKCZ

Purification: Affinity purified

Immunogène: PRKCZ antibody was raised using the N terminal of PRKCZ corresponding to a region with amino acids MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKCZ Blocking Peptide, catalog no. 33R-5876, is also available for use as a blocking control in assays to test for specificity of this PRKCZ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PKC zeta

Antigène: PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))

Autre désignation: PRKCZ (PRKCZ Produits)

Synonymes: anticorps TPKC, anticorps PKCzeta, anticorps prkcz-A, anticorps pkc-zeta, anticorps PRKCZ, anticorps pkc2, anticorps PKC-ZETA, anticorps PKC2, anticorps AI098070, anticorps C80388, anticorps Pkcz, anticorps R74924, anticorps aPKCzeta, anticorps zetaPKC, anticorps 14-3-3-zetaisoform, anticorps r14-3-3, anticorps pkcz, anticorps si:ch211-150o23.4, anticorps protein kinase C zeta L homeolog, anticorps protein kinase C zeta, anticorps protein kinase C, zeta, anticorps prkcz.L, anticorps PRKCZ, anticorps prkcz, anticorps Prkcz

Sujet: Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Signalisation RTK, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling